AB-H00004485-B01P
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 50 ug |
Gene Name | MST1 |
Gene Alias | D3F15S2|DNF15S2|HGFL|MSP|NF15S2 |
Gene Description | macrophage stimulating 1 (hepatocyte growth factor-like) |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Tr |
Immunogen Prot. Seq | MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQLLPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRGTMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYCRNPDGSERPWCYTTD |
Antigen species Target species | Human |
Quality control testing | Antibody reactive against mammalian transfected lysate. |
Immunogen | MST1 (NP_066278.2, 1 a.a. ~ 711 a.a) full-length human protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 4485 |