MSN polyclonal antibody (A01)
  • MSN polyclonal antibody (A01)

MSN polyclonal antibody (A01)

Ref: AB-H00004478-A01
MSN polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MSN.
Información adicional
Size 50 uL
Gene Name MSN
Gene Alias -
Gene Description moesin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELAN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MSN (NP_002435, 422 a.a. ~ 531 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4478

Enviar un mensaje


MSN polyclonal antibody (A01)

MSN polyclonal antibody (A01)