MSI1 monoclonal antibody (M12), clone 4C7
  • MSI1 monoclonal antibody (M12), clone 4C7

MSI1 monoclonal antibody (M12), clone 4C7

Ref: AB-H00004440-M12
MSI1 monoclonal antibody (M12), clone 4C7

Información del producto

Mouse monoclonal antibody raised against a full length recombinant MSI1.
Información adicional
Size 100 ug
Gene Name MSI1
Gene Alias -
Gene Description musashi homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,ELISA
Immunogen Prot. Seq MSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MSI1 (NP_002433, 190 a.a. ~ 273 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4440
Clone Number 4C7
Iso type IgG2a Kappa

Enviar un mensaje


MSI1 monoclonal antibody (M12), clone 4C7

MSI1 monoclonal antibody (M12), clone 4C7