MSI1 MaxPab rabbit polyclonal antibody (D01)
  • MSI1 MaxPab rabbit polyclonal antibody (D01)

MSI1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004440-D01
MSI1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MSI1 protein.
Información adicional
Size 100 uL
Gene Name MSI1
Gene Alias -
Gene Description musashi homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MSI1 (NP_002433.1, 1 a.a. ~ 362 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4440

Enviar un mensaje


MSI1 MaxPab rabbit polyclonal antibody (D01)

MSI1 MaxPab rabbit polyclonal antibody (D01)