MSH4 polyclonal antibody (A01)
  • MSH4 polyclonal antibody (A01)

MSH4 polyclonal antibody (A01)

Ref: AB-H00004438-A01
MSH4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MSH4.
Información adicional
Size 50 uL
Gene Name MSH4
Gene Alias -
Gene Description mutS homolog 4 (E. coli)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq YKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEKTEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MSH4 (NP_002431, 831 a.a. ~ 936 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4438

Enviar un mensaje


MSH4 polyclonal antibody (A01)

MSH4 polyclonal antibody (A01)