CITED1 MaxPab rabbit polyclonal antibody (D01)
  • CITED1 MaxPab rabbit polyclonal antibody (D01)

CITED1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004435-D01
CITED1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CITED1 protein.
Información adicional
Size 100 uL
Gene Name CITED1
Gene Alias MSG1
Gene Description Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CITED1 (NP_004134.1, 1 a.a. ~ 193 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4435

Enviar un mensaje


CITED1 MaxPab rabbit polyclonal antibody (D01)

CITED1 MaxPab rabbit polyclonal antibody (D01)