MYO1B polyclonal antibody (A01)
  • MYO1B polyclonal antibody (A01)

MYO1B polyclonal antibody (A01)

Ref: AB-H00004430-A01
MYO1B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MYO1B.
Información adicional
Size 50 uL
Gene Name MYO1B
Gene Alias myr1
Gene Description myosin IB
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYO1B (NP_036355, 979 a.a. ~ 1078 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4430

Enviar un mensaje


MYO1B polyclonal antibody (A01)

MYO1B polyclonal antibody (A01)