MRC1 polyclonal antibody (A01)
  • MRC1 polyclonal antibody (A01)

MRC1 polyclonal antibody (A01)

Ref: AB-H00004360-A01
MRC1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MRC1.
Información adicional
Size 50 uL
Gene Name MRC1
Gene Alias CD206|CLEC13D|MMR
Gene Description mannose receptor, C type 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MRC1 (NP_002429, 22 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4360

Enviar un mensaje


MRC1 polyclonal antibody (A01)

MRC1 polyclonal antibody (A01)