MPST monoclonal antibody (M01), clone 1B5
  • MPST monoclonal antibody (M01), clone 1B5

MPST monoclonal antibody (M01), clone 1B5

Ref: AB-H00004357-M01
MPST monoclonal antibody (M01), clone 1B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MPST.
Información adicional
Size 100 ug
Gene Name MPST
Gene Alias MGC24539|MST|TST2
Gene Description mercaptopyruvate sulfurtransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,S-ELISA,ELISA
Immunogen Prot. Seq MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPST (NP_001013454.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4357
Clone Number 1B5
Iso type IgG1 Kappa

Enviar un mensaje


MPST monoclonal antibody (M01), clone 1B5

MPST monoclonal antibody (M01), clone 1B5