MPP1 monoclonal antibody (M03), clone 2E5
  • MPP1 monoclonal antibody (M03), clone 2E5

MPP1 monoclonal antibody (M03), clone 2E5

Ref: AB-H00004354-M03
MPP1 monoclonal antibody (M03), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MPP1.
Información adicional
Size 100 ug
Gene Name MPP1
Gene Alias AAG12|DXS552|DXS552E|EMP55|MRG1|PEMP
Gene Description membrane protein, palmitoylated 1, 55kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPP1 (NP_002427, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4354
Clone Number 2E5
Iso type IgG2a Kappa

Enviar un mensaje


MPP1 monoclonal antibody (M03), clone 2E5

MPP1 monoclonal antibody (M03), clone 2E5