Ver mas grande
MPP1 monoclonal antibody (M03), clone 2E5
AB-H00004354-M03
Producto nuevo
MPP1 monoclonal antibody (M03), clone 2E5
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | MPP1 |
| Gene Alias | AAG12|DXS552|DXS552E|EMP55|MRG1|PEMP |
| Gene Description | membrane protein, palmitoylated 1, 55kDa |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVAR |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MPP1 (NP_002427, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 4354 |
| Clone Number | 2E5 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant MPP1.