MPP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • MPP1 purified MaxPab rabbit polyclonal antibody (D01P)

MPP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004354-D01P
MPP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MPP1 protein.
Información adicional
Size 100 ug
Gene Name MPP1
Gene Alias AAG12|DXS552|DXS552E|EMP55|MRG1|PEMP
Gene Description membrane protein, palmitoylated 1, 55kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MPP1 (NP_002427.1, 1 a.a. ~ 466 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4354

Enviar un mensaje


MPP1 purified MaxPab rabbit polyclonal antibody (D01P)

MPP1 purified MaxPab rabbit polyclonal antibody (D01P)