MPP1 polyclonal antibody (A01)
  • MPP1 polyclonal antibody (A01)

MPP1 polyclonal antibody (A01)

Ref: AB-H00004354-A01
MPP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant MPP1.
Información adicional
Size 50 uL
Gene Name MPP1
Gene Alias AAG12|DXS552|DXS552E|EMP55|MRG1|PEMP
Gene Description membrane protein, palmitoylated 1, 55kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARILHGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIPNQQSRLPALQMFMRAQFDYDPKKDNLIPCKEAGLKFATGDIIQIINKDDSNWWQGRVEGSSKESAGLIPSPELQEWRVASMAQSAPSEAPSCSPFGKKKKYKDKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPP1 (AAH02392, 1 a.a. ~ 466 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4354

Enviar un mensaje


MPP1 polyclonal antibody (A01)

MPP1 polyclonal antibody (A01)