MPO monoclonal antibody (M01), clone 3E11
  • MPO monoclonal antibody (M01), clone 3E11

MPO monoclonal antibody (M01), clone 3E11

Ref: AB-H00004353-M01
MPO monoclonal antibody (M01), clone 3E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MPO.
Información adicional
Size 100 ug
Gene Name MPO
Gene Alias -
Gene Description myeloperoxidase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPO (NP_000241, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4353
Clone Number 3E11
Iso type IgG2b Kappa

Enviar un mensaje


MPO monoclonal antibody (M01), clone 3E11

MPO monoclonal antibody (M01), clone 3E11