MPG monoclonal antibody (M04), clone 1E10
  • MPG monoclonal antibody (M04), clone 1E10

MPG monoclonal antibody (M04), clone 1E10

Ref: AB-H00004350-M04
MPG monoclonal antibody (M04), clone 1E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MPG.
Información adicional
Size 100 ug
Gene Name MPG
Gene Alias AAG|APNG|CRA36.1|MDG|Mid1|PIG11|PIG16|anpg
Gene Description N-methylpurine-DNA glycosylase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4350
Clone Number 1E10
Iso type IgG2a Kappa

Enviar un mensaje


MPG monoclonal antibody (M04), clone 1E10

MPG monoclonal antibody (M04), clone 1E10