MOS MaxPab rabbit polyclonal antibody (D01)
  • MOS MaxPab rabbit polyclonal antibody (D01)

MOS MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004342-D01
MOS MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MOS protein.
Información adicional
Size 100 uL
Gene Name MOS
Gene Alias MGC119962|MGC119963|MSV
Gene Description v-mos Moloney murine sarcoma viral oncogene homolog
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MOS (NP_005363.1, 1 a.a. ~ 346 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4342

Enviar un mensaje


MOS MaxPab rabbit polyclonal antibody (D01)

MOS MaxPab rabbit polyclonal antibody (D01)