MOBP monoclonal antibody (M08), clone 4C2
  • MOBP monoclonal antibody (M08), clone 4C2

MOBP monoclonal antibody (M08), clone 4C2

Ref: AB-H00004336-M08
MOBP monoclonal antibody (M08), clone 4C2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MOBP.
Información adicional
Size 100 ug
Gene Name MOBP
Gene Alias MGC87379
Gene Description myelin-associated oligodendrocyte basic protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MOBP (AAH22471, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4336
Clone Number 4C2
Iso type IgG1 Kappa

Enviar un mensaje


MOBP monoclonal antibody (M08), clone 4C2

MOBP monoclonal antibody (M08), clone 4C2