MNT polyclonal antibody (A01)
  • MNT polyclonal antibody (A01)

MNT polyclonal antibody (A01)

Ref: AB-H00004335-A01
MNT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MNT.
Información adicional
Size 50 uL
Gene Name MNT
Gene Alias MAD6|MXD6|ROX|bHLHd3
Gene Description MAX binding protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SAPSPAVQLAPATPPIGHITVHPATLNHVAHLGSQLPLYPQPVAVSHIAHTLSHQQVNGTAGLGPPATVMAKPAVGAQVVHHPQLVGQTVLNPVTMVTMPSFPVSTLKLA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MNT (NP_064706, 473 a.a. ~ 582 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4335

Enviar un mensaje


MNT polyclonal antibody (A01)

MNT polyclonal antibody (A01)