MMP19 purified MaxPab mouse polyclonal antibody (B01P)
  • MMP19 purified MaxPab mouse polyclonal antibody (B01P)

MMP19 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004327-B01P
MMP19 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MMP19 protein.
Información adicional
Size 50 ug
Gene Name MMP19
Gene Alias MMP18|RASI-1
Gene Description matrix metallopeptidase 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMP19 (NP_002420.1, 1 a.a. ~ 508 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4327

Enviar un mensaje


MMP19 purified MaxPab mouse polyclonal antibody (B01P)

MMP19 purified MaxPab mouse polyclonal antibody (B01P)