MMP13 monoclonal antibody (M07), clone 3B11
  • MMP13 monoclonal antibody (M07), clone 3B11

MMP13 monoclonal antibody (M07), clone 3B11

Ref: AB-H00004322-M07
MMP13 monoclonal antibody (M07), clone 3B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MMP13.
Información adicional
Size 100 ug
Gene Name MMP13
Gene Alias CLG3
Gene Description matrix metallopeptidase 13 (collagenase 3)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq ILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MMP13 (NP_002418, 362 a.a. ~ 471 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4322
Clone Number 3B11
Iso type IgG2a Kappa

Enviar un mensaje


MMP13 monoclonal antibody (M07), clone 3B11

MMP13 monoclonal antibody (M07), clone 3B11