MMP13 MaxPab rabbit polyclonal antibody (D01)
  • MMP13 MaxPab rabbit polyclonal antibody (D01)

MMP13 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004322-D01
MMP13 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MMP13 protein.
Información adicional
Size 100 uL
Gene Name MMP13
Gene Alias CLG3
Gene Description matrix metallopeptidase 13 (collagenase 3)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMP13 (NP_002418.1, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4322

Enviar un mensaje


MMP13 MaxPab rabbit polyclonal antibody (D01)

MMP13 MaxPab rabbit polyclonal antibody (D01)