MMP13 purified MaxPab mouse polyclonal antibody (B01P)
  • MMP13 purified MaxPab mouse polyclonal antibody (B01P)

MMP13 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004322-B01P
MMP13 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MMP13 protein.
Información adicional
Size 50 ug
Gene Name MMP13
Gene Alias CLG3
Gene Description matrix metallopeptidase 13 (collagenase 3)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMP13 (NP_002418, 1 a.a. ~ 471 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4322

Enviar un mensaje


MMP13 purified MaxPab mouse polyclonal antibody (B01P)

MMP13 purified MaxPab mouse polyclonal antibody (B01P)