MMP13 polyclonal antibody (A01)
  • MMP13 polyclonal antibody (A01)

MMP13 polyclonal antibody (A01)

Ref: AB-H00004322-A01
MMP13 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MMP13.
Información adicional
Size 50 uL
Gene Name MMP13
Gene Alias CLG3
Gene Description matrix metallopeptidase 13 (collagenase 3)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MMP13 (NP_002418, 362 a.a. ~ 471 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4322

Enviar un mensaje


MMP13 polyclonal antibody (A01)

MMP13 polyclonal antibody (A01)