MMP1 MaxPab rabbit polyclonal antibody (D01)
  • MMP1 MaxPab rabbit polyclonal antibody (D01)

MMP1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004312-D01
MMP1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MMP1 protein.
Información adicional
Size 100 uL
Gene Name MMP1
Gene Alias CLG|CLGN
Gene Description matrix metallopeptidase 1 (interstitial collagenase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IHC-P,IP
Immunogen Prot. Seq MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MMP1 (NP_002412.1, 1 a.a. ~ 469 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4312

Enviar un mensaje


MMP1 MaxPab rabbit polyclonal antibody (D01)

MMP1 MaxPab rabbit polyclonal antibody (D01)