MMP1 polyclonal antibody (A01)
  • MMP1 polyclonal antibody (A01)

MMP1 polyclonal antibody (A01)

Ref: AB-H00004312-A01
MMP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MMP1.
Información adicional
Size 50 uL
Gene Name MMP1
Gene Alias CLG|CLGN
Gene Description matrix metallopeptidase 1 (interstitial collagenase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MMP1 (AAH13875, 370 a.a. ~ 469 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4312

Enviar un mensaje


MMP1 polyclonal antibody (A01)

MMP1 polyclonal antibody (A01)