MLLT1 monoclonal antibody (M01), clone 3H2
  • MLLT1 monoclonal antibody (M01), clone 3H2

MLLT1 monoclonal antibody (M01), clone 3H2

Ref: AB-H00004298-M01
MLLT1 monoclonal antibody (M01), clone 3H2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MLLT1.
Información adicional
Size 100 ug
Gene Name MLLT1
Gene Alias ENL|LTG19|YEATS1
Gene Description myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq GRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MLLT1 (NP_005925, 472 a.a. ~ 558 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4298
Clone Number 3H2
Iso type IgG2a Kappa

Enviar un mensaje


MLLT1 monoclonal antibody (M01), clone 3H2

MLLT1 monoclonal antibody (M01), clone 3H2