MAP3K11 monoclonal antibody (M02), clone 3D11
  • MAP3K11 monoclonal antibody (M02), clone 3D11

MAP3K11 monoclonal antibody (M02), clone 3D11

Ref: AB-H00004296-M02
MAP3K11 monoclonal antibody (M02), clone 3D11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP3K11.
Información adicional
Size 100 ug
Gene Name MAP3K11
Gene Alias MGC17114|MLK-3|MLK3|PTK1|SPRK
Gene Description mitogen-activated protein kinase kinase kinase 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K11 (NP_002410, 741 a.a. ~ 847 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4296
Clone Number 3D11
Iso type IgG2a Kappa

Enviar un mensaje


MAP3K11 monoclonal antibody (M02), clone 3D11

MAP3K11 monoclonal antibody (M02), clone 3D11