MAP3K11 polyclonal antibody (A01)
  • MAP3K11 polyclonal antibody (A01)

MAP3K11 polyclonal antibody (A01)

Ref: AB-H00004296-A01
MAP3K11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAP3K11.
Información adicional
Size 50 uL
Gene Name MAP3K11
Gene Alias MGC17114|MLK-3|MLK3|PTK1|SPRK
Gene Description mitogen-activated protein kinase kinase kinase 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K11 (NP_002410, 741 a.a. ~ 847 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4296

Enviar un mensaje


MAP3K11 polyclonal antibody (A01)

MAP3K11 polyclonal antibody (A01)