CXCL9 monoclonal antibody (M06), clone 1F5
  • CXCL9 monoclonal antibody (M06), clone 1F5

CXCL9 monoclonal antibody (M06), clone 1F5

Ref: AB-H00004283-M06
CXCL9 monoclonal antibody (M06), clone 1F5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CXCL9.
Información adicional
Size 100 ug
Gene Name CXCL9
Gene Alias CMK|Humig|MIG|SCYB9|crg-10
Gene Description chemokine (C-X-C motif) ligand 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCL9 (AAH63122, 23 a.a. ~ 125 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4283
Clone Number 1F5
Iso type IgG2a Kappa

Enviar un mensaje


CXCL9 monoclonal antibody (M06), clone 1F5

CXCL9 monoclonal antibody (M06), clone 1F5