MICA purified MaxPab mouse polyclonal antibody (B01P)
  • MICA purified MaxPab mouse polyclonal antibody (B01P)

MICA purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004276-B01P
MICA purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MICA protein.
Información adicional
Size 50 ug
Gene Name MICA
Gene Alias FLJ60820|MGC111087|PERB11.1
Gene Description MHC class I polypeptide-related sequence A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MICA (NP_000238.1, 1 a.a. ~ 383 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4276

Enviar un mensaje


MICA purified MaxPab mouse polyclonal antibody (B01P)

MICA purified MaxPab mouse polyclonal antibody (B01P)