MICA purified MaxPab mouse polyclonal antibody (B01P) Ver mas grande

MICA purified MaxPab mouse polyclonal antibody (B01P)

AB-H00004276-B01P

Producto nuevo

MICA purified MaxPab mouse polyclonal antibody (B01P)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 50 ug
Gene Name MICA
Gene Alias FLJ60820|MGC111087|PERB11.1
Gene Description MHC class I polypeptide-related sequence A
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MICA (NP_000238.1, 1 a.a. ~ 383 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4276

Más información

Mouse polyclonal antibody raised against a full-length human MICA protein.

Consulta sobre un producto

MICA purified MaxPab mouse polyclonal antibody (B01P)

MICA purified MaxPab mouse polyclonal antibody (B01P)