MGMT MaxPab rabbit polyclonal antibody (D01)
  • MGMT MaxPab rabbit polyclonal antibody (D01)

MGMT MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004255-D01
MGMT MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MGMT protein.
Información adicional
Size 100 uL
Gene Name MGMT
Gene Alias -
Gene Description O-6-methylguanine-DNA methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MGMT (NP_002403.1, 1 a.a. ~ 207 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4255

Enviar un mensaje


MGMT MaxPab rabbit polyclonal antibody (D01)

MGMT MaxPab rabbit polyclonal antibody (D01)