MFNG purified MaxPab mouse polyclonal antibody (B01P)
  • MFNG purified MaxPab mouse polyclonal antibody (B01P)

MFNG purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004242-B01P
MFNG purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MFNG protein.
Información adicional
Size 50 ug
Gene Name MFNG
Gene Alias -
Gene Description MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MFNG (NP_002396.2, 1 a.a. ~ 321 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4242

Enviar un mensaje


MFNG purified MaxPab mouse polyclonal antibody (B01P)

MFNG purified MaxPab mouse polyclonal antibody (B01P)