MET purified MaxPab mouse polyclonal antibody (B01P)
  • MET purified MaxPab mouse polyclonal antibody (B01P)

MET purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004233-B01P
MET purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MET protein.
Información adicional
Size 50 ug
Gene Name MET
Gene Alias AUTS9|HGFR|RCCP2|c-Met
Gene Description met proto-oncogene (hepatocyte growth factor receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MET (NP_000236, 1 a.a. ~ 1390 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4233

Enviar un mensaje


MET purified MaxPab mouse polyclonal antibody (B01P)

MET purified MaxPab mouse polyclonal antibody (B01P)