MET polyclonal antibody (A01)
  • MET polyclonal antibody (A01)

MET polyclonal antibody (A01)

Ref: AB-H00004233-A01
MET polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MET.
Información adicional
Size 50 uL
Gene Name MET
Gene Alias AUTS9|HGFR|RCCP2|c-Met
Gene Description met proto-oncogene (hepatocyte growth factor receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq CKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MET (NM_000245, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4233

Enviar un mensaje


MET polyclonal antibody (A01)

MET polyclonal antibody (A01)