MEOX1 monoclonal antibody (M02), clone 1A12
  • MEOX1 monoclonal antibody (M02), clone 1A12

MEOX1 monoclonal antibody (M02), clone 1A12

Ref: AB-H00004222-M02
MEOX1 monoclonal antibody (M02), clone 1A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MEOX1.
Información adicional
Size 100 ug
Gene Name MEOX1
Gene Alias MOX1
Gene Description mesenchyme homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MEOX1 (NP_004518.1, 165 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4222
Clone Number 1A12
Iso type IgG2a Kappa

Enviar un mensaje


MEOX1 monoclonal antibody (M02), clone 1A12

MEOX1 monoclonal antibody (M02), clone 1A12