MEOX1 purified MaxPab mouse polyclonal antibody (B01P)
  • MEOX1 purified MaxPab mouse polyclonal antibody (B01P)

MEOX1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004222-B01P
MEOX1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MEOX1 protein.
Información adicional
Size 50 ug
Gene Name MEOX1
Gene Alias MOX1
Gene Description mesenchyme homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MEOX1 (NP_004518.1, 1 a.a. ~ 254 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4222

Enviar un mensaje


MEOX1 purified MaxPab mouse polyclonal antibody (B01P)

MEOX1 purified MaxPab mouse polyclonal antibody (B01P)