MEN1 purified MaxPab rabbit polyclonal antibody (D01P)
  • MEN1 purified MaxPab rabbit polyclonal antibody (D01P)

MEN1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004221-D01P
MEN1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MEN1 protein.
Información adicional
Size 100 ug
Gene Name MEN1
Gene Alias MEAI|SCG2
Gene Description multiple endocrine neoplasia I
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWSWLYLKGSYMRCDRKMEVAFMVCAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MEN1 (AAH02544.1, 1 a.a. ~ 575 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4221

Enviar un mensaje


MEN1 purified MaxPab rabbit polyclonal antibody (D01P)

MEN1 purified MaxPab rabbit polyclonal antibody (D01P)