MAP3K4 monoclonal antibody (M11A), clone X1
  • MAP3K4 monoclonal antibody (M11A), clone X1

MAP3K4 monoclonal antibody (M11A), clone X1

Ref: AB-H00004216-M11A
MAP3K4 monoclonal antibody (M11A), clone X1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP3K4.
Información adicional
Size 200 uL
Gene Name MAP3K4
Gene Alias FLJ42439|KIAA0213|MAPKKK4|MEKK4|MTK1|PRO0412
Gene Description mitogen-activated protein kinase kinase kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 4216
Clone Number X1
Iso type IgG2b

Enviar un mensaje


MAP3K4 monoclonal antibody (M11A), clone X1

MAP3K4 monoclonal antibody (M11A), clone X1