MAP3K4 monoclonal antibody (M09), clone 5D4
  • MAP3K4 monoclonal antibody (M09), clone 5D4

MAP3K4 monoclonal antibody (M09), clone 5D4

Ref: AB-H00004216-M09
MAP3K4 monoclonal antibody (M09), clone 5D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP3K4.
Información adicional
Size 100 ug
Gene Name MAP3K4
Gene Alias FLJ42439|KIAA0213|MAPKKK4|MEKK4|MTK1|PRO0412
Gene Description mitogen-activated protein kinase kinase kinase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4216
Clone Number 5D4
Iso type IgG2b Kappa

Enviar un mensaje


MAP3K4 monoclonal antibody (M09), clone 5D4

MAP3K4 monoclonal antibody (M09), clone 5D4