MEIS2 purified MaxPab rabbit polyclonal antibody (D01P)
  • MEIS2 purified MaxPab rabbit polyclonal antibody (D01P)

MEIS2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004212-D01P
MEIS2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MEIS2 protein.
Información adicional
Size 100 ug
Gene Name MEIS2
Gene Alias HsT18361|MGC2820|MRG1
Gene Description Meis homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MEIS2 (NP_733776.1, 1 a.a. ~ 470 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4212

Enviar un mensaje


MEIS2 purified MaxPab rabbit polyclonal antibody (D01P)

MEIS2 purified MaxPab rabbit polyclonal antibody (D01P)