MEFV monoclonal antibody (M01), clone 4E6
  • MEFV monoclonal antibody (M01), clone 4E6

MEFV monoclonal antibody (M01), clone 4E6

Ref: AB-H00004210-M01
MEFV monoclonal antibody (M01), clone 4E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MEFV.
Información adicional
Size 100 ug
Gene Name MEFV
Gene Alias FMF|MEF|MGC126560|MGC126586|TRIM20
Gene Description Mediterranean fever
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MEFV (NP_000234, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4210
Clone Number 4E6
Iso type IgG2a Kappa

Enviar un mensaje


MEFV monoclonal antibody (M01), clone 4E6

MEFV monoclonal antibody (M01), clone 4E6