MEF2D purified MaxPab rabbit polyclonal antibody (D01P)
  • MEF2D purified MaxPab rabbit polyclonal antibody (D01P)

MEF2D purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004209-D01P
MEF2D purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MEF2D protein.
Información adicional
Size 100 ug
Gene Name MEF2D
Gene Alias DKFZp686I1536
Gene Description myocyte enhancer factor 2D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGEDSLEQSPLLEDKYRRASEELDGLFRRYGSTVPAPNFAMPVTVPVSNQSSLQFSNPSGSLVTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MEF2D (NP_005911.1, 1 a.a. ~ 521 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4209

Enviar un mensaje


MEF2D purified MaxPab rabbit polyclonal antibody (D01P)

MEF2D purified MaxPab rabbit polyclonal antibody (D01P)