MEF2C purified MaxPab rabbit polyclonal antibody (D01P)
  • MEF2C purified MaxPab rabbit polyclonal antibody (D01P)

MEF2C purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004208-D01P
MEF2C purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MEF2C protein.
Información adicional
Size 100 ug
Gene Name MEF2C
Gene Alias -
Gene Description myocyte enhancer factor 2C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYASTDMDKVLLKYTEYNEQHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKINEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MEF2C (AAH26341.1, 1 a.a. ~ 469 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4208

Enviar un mensaje


MEF2C purified MaxPab rabbit polyclonal antibody (D01P)

MEF2C purified MaxPab rabbit polyclonal antibody (D01P)