MEF2B monoclonal antibody (M24), clone 4B5
  • MEF2B monoclonal antibody (M24), clone 4B5

MEF2B monoclonal antibody (M24), clone 4B5

Ref: AB-H00004207-M24
MEF2B monoclonal antibody (M24), clone 4B5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant MEF2B.
Información adicional
Size 100 ug
Gene Name MEF2B
Gene Alias FLJ32599|FLJ46391|MGC189732|MGC189763|RSRFR2
Gene Description myocyte enhancer factor 2B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4207
Clone Number 4B5
Iso type IgG2a Kappa

Enviar un mensaje


MEF2B monoclonal antibody (M24), clone 4B5

MEF2B monoclonal antibody (M24), clone 4B5