MDS1 purified MaxPab mouse polyclonal antibody (B01P)
  • MDS1 purified MaxPab mouse polyclonal antibody (B01P)

MDS1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00004197-B01P
MDS1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MDS1 protein.
Información adicional
Size 50 ug
Gene Name MDS1
Gene Alias MDS1-EVI1|PRDM3
Gene Description myelodysplasia syndrome 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MDS1 (NP_004982.1, 1 a.a. ~ 169 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4197

Enviar un mensaje


MDS1 purified MaxPab mouse polyclonal antibody (B01P)

MDS1 purified MaxPab mouse polyclonal antibody (B01P)