MDM2 monoclonal antibody (M01), clone 1A7
  • MDM2 monoclonal antibody (M01), clone 1A7

MDM2 monoclonal antibody (M01), clone 1A7

Ref: AB-H00004193-M01
MDM2 monoclonal antibody (M01), clone 1A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MDM2.
Información adicional
Size 100 ug
Gene Name MDM2
Gene Alias HDMX|MGC71221|hdm2
Gene Description Mdm2 p53 binding protein homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab,PLA-Ce
Immunogen Prot. Seq TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MDM2 (NP_002383, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4193
Clone Number 1A7
Iso type IgG1 Kappa

Enviar un mensaje


MDM2 monoclonal antibody (M01), clone 1A7

MDM2 monoclonal antibody (M01), clone 1A7