MDM2 polyclonal antibody (A01)
  • MDM2 polyclonal antibody (A01)

MDM2 polyclonal antibody (A01)

Ref: AB-H00004193-A01
MDM2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MDM2.
Información adicional
Size 50 uL
Gene Name MDM2
Gene Alias HDMX|MGC71221|hdm2
Gene Description Mdm2 p53 binding protein homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq TMIYRNLVVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQRKRHKSDSISLSFDESLALC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MDM2 (NP_002383, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4193

Enviar un mensaje


MDM2 polyclonal antibody (A01)

MDM2 polyclonal antibody (A01)