MDK MaxPab rabbit polyclonal antibody (D01)
  • MDK MaxPab rabbit polyclonal antibody (D01)

MDK MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00004192-D01
MDK MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MDK protein.
Información adicional
Size 100 uL
Gene Name MDK
Gene Alias FLJ27379|MK|NEGF2
Gene Description midkine (neurite growth-promoting factor 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MDK (NP_001012333.1, 1 a.a. ~ 143 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 4192

Enviar un mensaje


MDK MaxPab rabbit polyclonal antibody (D01)

MDK MaxPab rabbit polyclonal antibody (D01)