MDH1 purified MaxPab rabbit polyclonal antibody (D01P)
  • MDH1 purified MaxPab rabbit polyclonal antibody (D01P)

MDH1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00004190-D01P
MDH1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MDH1 protein.
Información adicional
Size 100 ug
Gene Name MDH1
Gene Alias MDH-s|MDHA|MGC:1375|MOR2
Gene Description malate dehydrogenase 1, NAD (soluble)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MDH1 (NP_005908.1, 1 a.a. ~ 334 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4190

Enviar un mensaje


MDH1 purified MaxPab rabbit polyclonal antibody (D01P)

MDH1 purified MaxPab rabbit polyclonal antibody (D01P)