ADAM11 polyclonal antibody (A01)
  • ADAM11 polyclonal antibody (A01)

ADAM11 polyclonal antibody (A01)

Ref: AB-H00004185-A01
ADAM11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ADAM11.
Información adicional
Size 50 uL
Gene Name ADAM11
Gene Alias MDC
Gene Description ADAM metallopeptidase domain 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ADAM11 (NP_002381, 230 a.a. ~ 333 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 4185

Enviar un mensaje


ADAM11 polyclonal antibody (A01)

ADAM11 polyclonal antibody (A01)