SMCP monoclonal antibody (M04), clone 4F4
  • SMCP monoclonal antibody (M04), clone 4F4

SMCP monoclonal antibody (M04), clone 4F4

Ref: AB-H00004184-M04
SMCP monoclonal antibody (M04), clone 4F4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SMCP.
Información adicional
Size 100 ug
Gene Name SMCP
Gene Alias HSMCSGEN1|MCS|MCSP|MGC26305|MGC26519
Gene Description sperm mitochondria-associated cysteine-rich protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMCP (AAH14593, 1 a.a. ~ 116 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 4184
Clone Number 4F4
Iso type IgG2a Kappa

Enviar un mensaje


SMCP monoclonal antibody (M04), clone 4F4

SMCP monoclonal antibody (M04), clone 4F4